- Search results for GeneID 148003
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
3 products were found matching "GeneID 148003"!
Close filters
Filter by:
No results were found for the filter!
Item number: CR-C01167-100UG
Sequence: SFLTVPYKLP VSLSVGSCVI IKGTLIDSSI NEPQLQVDFY TEMNEDSEIA FHLRVHLGRR VVMNSREFGI WMLEENLHYV PFEDGKPFDL LNEYEVKVNG EYIYAFVHRI PPSYVKMIQV WRDVSLDSVL with polyhistidine tag at the Nterminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Binds lactose with high affinity....
Keywords: | Galectin-16 |
Application: | Active lectin |
Expressed in: | E.coli |
From 108.00€
*
Item number: ABE-32-6365-10
Source: Escherichia Coli.Sterile Filtered colorless solution.Galectin-16 (LGALS16) binds lactose with high affinity. LGALS16 is a strong inducer of T-cell apoptosis.LGALS16 Human Recombinant produced in E.Coli is a non-glycosylated polypeptide chain containing having a molecular mass of 16kDa.The LGALS16 also...
Expressed in: | E.coli |
Origin: | human |
From 438.00€
*
Item number: E-PKSH034190.100
Sequence: MSFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCHNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Binds lactose with high affinity. Strong...
Keywords: | Galectin-16, Recombinant Human Galectin-16 protein(N-His) |
Expressed in: | E.coli |
Origin: | human |
MW: | 17.42 kD |
From 295.00€
*